Assay Kits

Jump to Filters
View as table Download
PCNA Rabbit Polyclonal Antibody
TA590137

USD 482.00

In Stock

Rabbit Polyclonal PCNA Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
HDAC2 Rabbit Polyclonal Antibody
TA590734

USD 482.00

In Stock

Rabbit Polyclonal HDAC2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
MCM6 Rabbit Polyclonal Antibody
TA590213

USD 482.00

In Stock

Rabbit Polyclonal MCM6 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
BubR1 (BUB1B) Rabbit Polyclonal Antibody
TA590739

USD 482.00

In Stock

Rabbit Polyclonal BubR1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
c-Myc (MYC) Mouse Monoclonal Capture Antibody [Clone ID: OTI3F2]
TA600496

USD 458.00

In Stock

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700496
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
Cyclin A2 (CCNA2) Rabbit Polyclonal Antibody
TA590075

USD 482.00

In Stock

Rabbit Polyclonal Cyclin A2 Antibody

Applications ELISA, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
c-Myc (MYC) Mouse Monoclonal Capture Antibody [Clone ID: OTI1A6]
TA600497

USD 458.00

In Stock

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700497
BubR1 (BUB1B) Mouse Monoclonal Capture Antibody [Clone ID: OTI3C7]
TA600521

USD 458.00

2 Weeks

purified BUB1B mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA700521, TA700531
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
c-Myc (MYC) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI1A6]
TA700496

USD 494.00

In Stock

MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600496
c-Myc (MYC) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI3F2]
TA700497

USD 494.00

In Stock

MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600497
Cyclin B2 (CCNB2) Rabbit Polyclonal Antibody
TA590623

USD 482.00

In Stock

Rabbit Polyclonal Cyclin B2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Chk2 (CHEK2) Mouse Monoclonal Capture Antibody [Clone ID: OTI2F4]
TA600006

USD 458.00

In Stock

CHEK2 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700006
Chk2 (CHEK2) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI4C10]
TA700006

USD 494.00

In Stock

CHEK2 biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600006