Germany
Japan
United Kingdom
China
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Assay Kits
View as table Download
Rabbit Polyclonal Ku80 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Active filters
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency
Filter by
Category
Target Symbol
- C-MYC (4)
- DNMT3B (3)
- C-MYB (2)
- P53 (2)
- BCL2 (1)
- BUBR1 (1)
- BYSL (1)
- CD30 (1)
- CDC25C (1)
- CRIPTO1 (1)
- CXADR (1)
- CYCLIN A2 (1)
- CYCLIN B2 (1)
- FKBP25 (1)
- GEMININ (1)
- HDAC2 (1)
- KU80 (1)
- MBD2 (1)
- MCM6 (1)
- MYH (1)
- NM23A (1)
- NUCLEOPHOSMIN (1)
- OTX2 (1)
- PAK1 (1)
- PCNA (1)
- PIAS2 (1)
- PPAP2C (1)
- PRION PROTEIN PRP (1)
- RFC4 (1)
- SCRAMBLASE 1 (1)
- SFRS3 (1)
- SP1 (1)
- SSB (1)
- TGIF (1)
- TRIP (1)
- XPG (1)
Reactivities
Antibody Hosts
Conjugates
Assay Types
Pathways
- Cell cycle (13)
- Pathways in cancer (9)
- Small cell lung cancer (8)
- Chronic myeloid leukemia (7)
- Colorectal cancer (7)
- MAPK signaling pathway (7)
- Bladder cancer (6)
- Endometrial cancer (6)
- Thyroid cancer (6)
- Wnt signaling pathway (6)
- ErbB signaling pathway (5)
- Jak-STAT signaling pathway (5)
- Metabolic pathways (5)
- TGF-beta signaling pathway (5)
- Acute myeloid leukemia (4)
- Huntington's disease (4)
- Amyotrophic lateral sclerosis (ALS) (3)
- Apoptosis (3)
- Cysteine and methionine metabolism (3)
- DNA replication (3)
- Neurotrophin signaling pathway (3)
- Nucleotide excision repair (3)
- Progesterone-mediated oocyte maturation (3)
- Prostate cancer (3)
- p53 signaling pathway (3)
- Basal cell carcinoma (2)
- Base excision repair (2)
- Fc gamma R-mediated phagocytosis (2)
- Focal adhesion (2)
- Glioma (2)
- Melanoma (2)
- Mismatch repair (2)
- Non-small cell lung cancer (2)
- Oocyte meiosis (2)
- Pancreatic cancer (2)
- Axon guidance (1)
- Chemokine signaling pathway (1)
- Cytokine-cytokine receptor interaction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Ether lipid metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Natural killer cell mediated cytotoxicity (1)
- Non-homologous end-joining (1)
- Notch signaling pathway (1)
- Prion diseases (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- Regulation of actin cytoskeleton (1)
- Renal cell carcinoma (1)
- Sphingolipid metabolism (1)
- Spliceosome (1)
- Systemic lupus erythematosus (1)
- T cell receptor signaling pathway (1)
- Ubiquitin mediated proteolysis (1)
- Viral myocarditis (1)