Assay Kits

View as table Download

Anti-BRAF mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)

Applications ELISA, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BRAF mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications ELISA, IHC, IP, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BRAF mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications ELISA, IHC, IP, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Anti-BRAF mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)

Applications ELISA, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BRAF mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)

Applications ELISA, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BRAF mouse monoclonal antibody, clone OTI4A5 (formerly 4A5)

Applications ELISA, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-BRAF mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications ELISA, IHC, IP, WB
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

ERK2 (MAPK1) mouse monoclonal antibody, clone AT1A4, Purified

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal NRAS Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

KRAS mouse monoclonal antibody, clone AT2F8, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

KRAS mouse monoclonal antibody, clone AT2F8, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal PPARG Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein.