ELISA Kits

Jump to Filters
View as table Download
BAX Rabbit Polyclonal Antibody
TA590174

USD 482.00

In Stock

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
AKT2 Rabbit Polyclonal Antibody
TA590729

USD 482.00

In Stock

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
c-Jun (JUN) Rabbit Polyclonal Antibody
TA590119

USD 482.00

In Stock

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
NRAS Rabbit Polyclonal Antibody
TA590133

USD 482.00

In Stock

Rabbit Polyclonal NRAS Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
Fas Ligand (FASLG) Rabbit Polyclonal Antibody
TA590044

USD 482.00

In Stock

Rabbit Polyclonal Fas Ligand Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
JNK1 (MAPK8) Rabbit Polyclonal Antibody
TA590142

USD 482.00

In Stock

Rabbit Polyclonal JNK1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
IKB alpha (NFKBIA) Rabbit Polyclonal Antibody
TA590476

USD 482.00

In Stock

Rabbit Polyclonal IKB alpha Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
p73 (TP73) Rabbit Polyclonal Antibody
TA590603

USD 482.00

In Stock

Rabbit Polyclonal p73 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
BCL2 Rabbit Polyclonal Antibody
TA590781

USD 482.00

In Stock

Rabbit Polyclonal Bcl2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
BDNF Goat Polyclonal Antibody
GT41014-100

USD 645.00

2 Weeks

BDNF goat polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated