ELISA Kits

View as table Download

CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays

Applications ELISA, LMNX
Reactivities Human, Dog, Monkey, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700034, TA700035

CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600035, TA600047, TA600141

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700496

CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600035, TA600034

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays

Applications LMNX
Reactivities Human, Dog, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700034, TA700141

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700497

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP

CTNNB1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700035

MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600496

MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600497

Rabbit Polyclonal PPARG Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein.

c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Conjugation Unconjugated
Immunogen This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide.

CTNNB1 mouse monoclonal capture antibody, validated for Luminex assays

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700035, TA700047

CTNNB1 biotinylated mouse monoclonal detection antibody, validated for Luminex assays

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600034