Antibodies

Jump to Filters
View as table Download
VSIG4 Rabbit Polyclonal Antibody
TA356148

USD 539.00

5 Days

VSIG4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
VSIG4 Rabbit Polyclonal Antibody
TA346124

USD 485.00

5 Days

Rabbit Polyclonal Anti-VSIG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VSIG4 antibody: synthetic peptide directed towards the N terminal of human VSIG4. Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS
Anti-VSIG4 antibody(DMC268), IgG1 Chimeric mAb
TA389488

USD 595.00

4 Weeks

Anti-VSIG4 antibody(DMC268), IgG1 Chimeric mAb

Applications FC
Reactivities Human
Conjugation Unconjugated