Rabbit Polyclonal Anti-ULBP1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ULBP1 |
Rabbit Polyclonal Anti-ULBP1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ULBP1 |
Rabbit Polyclonal Anti-ULBP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ULBP1 antibody: synthetic peptide directed towards the N terminal of human ULBP1. Synthetic peptide located within the following region: MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC |
ULBP1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-216 of human ULBP1 (NP_079494.1). |
Modifications | Unmodified |