Rabbit polyclonal Sprouty-2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Sprouty-2 affinity purified antibody was purified from monospecific rabbit antiserum prepared via repeated immunizations with human sprouty-2 peptide. |
Rabbit Polyclonal Anti-SPRY2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPRY2 antibody: synthetic peptide directed towards the N terminal of human SPRY2. Synthetic peptide located within the following region: MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIR |
Rabbit Polyclonal Anti-SPRY2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPRY2 antibody: synthetic peptide directed towards the middle region of human SPRY2. Synthetic peptide located within the following region: LSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKS |
Germany
Japan
United Kingdom
China