Antibodies

Jump to Filters
View as table Download
Peroxiredoxin 3 (PRDX3) Rabbit Polyclonal Antibody
TA322470

USD 380.00

In Stock

Anti-PRDX3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 63-256 amino acids of human peroxiredoxin 3
Peroxiredoxin 3 (PRDX3) Rabbit Polyclonal Antibody
TA322472

USD 380.00

4 Weeks

Anti-PRDX3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 242-256 amino acids of Human peroxiredoxin 3
Peroxiredoxin 3 (PRDX3) Rabbit Polyclonal Antibody
TA322471

USD 380.00

In Stock

Anti-PRDX3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 63-256 amino acids of human peroxiredoxin 3
Peroxiredoxin 3 (PRDX3) Rabbit Polyclonal Antibody
AP20593PU-N

USD 465.00

3 Weeks

Peroxiredoxin 3 (PRDX3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Peroxiredoxin 3 (PRDX3) Rabbit Polyclonal Antibody
TA340179

USD 539.00

5 Days

Rabbit Polyclonal Anti-PRDX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX3 antibody: synthetic peptide directed towards the N terminal of human PRDX3. Synthetic peptide located within the following region: AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS
Peroxiredoxin 3 (PRDX3) (N-term) Rabbit Polyclonal Antibody
AP17663PU-N

USD 580.00

2 Weeks

Peroxiredoxin 3 (PRDX3) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human PRDX3