Rabbit Polyclonal Anti-PHF17 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the C terminal of human PHF17. Synthetic peptide located within the following region: YQYWKLKRKVNFNKPLITPKKDEEDNLAKREQDVLFRRLQLFTHLRQDLE |
Rabbit Polyclonal Anti-PHF17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the C terminal of human PHF17. Synthetic peptide located within the following region: EPFASLEQNREEAHRVSVRKQKLQQLEDEFYTFVNLLDVARALRLPEEVV |
Rabbit Polyclonal Anti-PHF17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the N terminal of human PHF17. Synthetic peptide located within the following region: MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRT |
Rabbit Polyclonal Anti-PHF17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the middle region of human PHF17. Synthetic peptide located within the following region: VNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKR |
JADE1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human JADE1 |
Germany
Japan
United Kingdom
China
