Antibodies

Jump to Filters
View as table Download
EEFSEC (C-term) Rabbit Polyclonal Antibody
AP51370PU-N

USD 580.00

2 Weeks

EEFSEC (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 547~577 amino acids from the C-terminal region of Human EEFSEC
EEFSEC Rabbit Polyclonal Antibody
TA338006

USD 539.00

5 Days

Rabbit Polyclonal Anti-EEFSEC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EEFSEC antibody is: synthetic peptide directed towards the C-terminal region of Human EEFSEC. Synthetic peptide located within the following region: IHIPGGLSPESKKILTPALKKRARAGRGEATRQEESAERSEPSQHVVLSL
EEFSEC Rabbit Polyclonal Antibody
TA338007

USD 539.00

5 Days

Rabbit Polyclonal Anti-EEFSEC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EEFSEC antibody is: synthetic peptide directed towards the C-terminal region of Human EEFSEC. Synthetic peptide located within the following region: AVTDNDEADKKAGQATEGHCPRQQWALVEFEKPVTCPRLCLVIGSRLDAD
EEFSEC Rabbit Polyclonal Antibody
TA375730

USD 365.00

3 Weeks

EEFSEC Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 347-596 of human EEFSEC (NP_068756.2).
Modifications Unmodified