Antibodies

Jump to Filters
View as table Download
DHRS9 Rabbit Polyclonal Antibody
TA375457

USD 365.00

3 Weeks

DHRS9 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-319 of human DHRS9 (NP_001135743.1).
Modifications Unmodified
DHRS9 Rabbit Polyclonal Antibody
TA337615

USD 539.00

5 Days

Rabbit Polyclonal Anti-DHRS9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DHRS9 antibody: synthetic peptide directed towards the middle region of human DHRS9. Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV
DHRS9 Rabbit Polyclonal Antibody
AP54884SU-N

USD 655.00

5 Weeks

DHRS9 rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from C-terminal of Human DHRS9 protein