Rabbit Polyclonal Anti-DCDC2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DCDC2B Antibody is: synthetic peptide directed towards the N-terminal region of Human DCDC2B. Synthetic peptide located within the following region: RGQYVAAGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGRQL |
Rabbit Polyclonal Anti-DCDC2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DCDC2B Antibody is: synthetic peptide directed towards the C-terminal region of Human DCDC2B. Synthetic peptide located within the following region: ELLVPSPSLPRGCWQPPGSKSRPHRQGAQGHRAQVTQPSPKEPDRIKPSA |
Germany
Japan
United Kingdom
China