Rabbit polyclonal anti-DNAI2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human DNAI2. |
Rabbit polyclonal anti-DNAI2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human DNAI2. |
Rabbit polyclonal antibody to DNAI2 (dynein, axonemal, intermediate chain 2)
Applications | WB |
Reactivities | Human (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 382 and 605 of DNAI2 (Uniprot ID#Q9GZS0) |
Rabbit Polyclonal anti-DNAI2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNAI2 antibody: synthetic peptide directed towards the N terminal of human DNAI2. Synthetic peptide located within the following region: TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHC |