Antibodies

View as table Download

RPRD1B mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPRD1B mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RPRD1B mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

RPRD1B mouse monoclonal antibody, clone OTI1C7 (formerly 1C7), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

RPRD1B mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

C20orf77 (RPRD1B) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 261~290 amino acids from the C-terminal region of Human RPR1B.

Rabbit Polyclonal Anti-RPRD1B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPRD1B antibody: synthetic peptide directed towards the middle region of human RPRD1B. Synthetic peptide located within the following region: KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS

Rabbit Polyclonal Anti-RPRD1B Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rprd1b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rprd1b. Synthetic peptide located within the following region: QERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDY