Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Acidic Calponin (CNN3) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human Calponin-3 |
Acidic Calponin (CNN3) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human Calponin 3 |
Goat Anti-Calponin 3 / CNN3 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HGEYQDDYPRDYQYS, from the C Terminus of the protein sequence according to NP_001830.1. |
Rabbit anti-CNN3 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal CNN3 antibody was raised against a 16 amino acid peptide corresponding to the C terminus residues of human CNN3. |
Rabbit Polyclonal Anti-CNN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNN3 antibody: synthetic peptide directed towards the C terminal of human CNN3. Synthetic peptide located within the following region: GLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGE |
CNN3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CNN3 |
Active filters
Target Symbol
- ACIDIC CALPONIN