Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ACLY mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-ACLY (ATP citrate lyase) mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ACLY Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACLY |
Rabbit Polyclonal Anti-ACLY Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACLY |
ATP citrate lyase (ACLY) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 430-480 of Human ATP-Citrate synthase. |
Rabbit Polyclonal anti-ACLY antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI |
Rabbit Polyclonal anti-ACLY antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACLY antibody: synthetic peptide directed towards the middle region of human ACLY. Synthetic peptide located within the following region: LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA |
USD 380.00
4 Weeks
Mouse Monoclonal ATP-Citrate Lyase (C-terminus) Antibody
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |