Antibodies

Jump to Filters
View as table Download
SFRS3 (SRSF3) (C-term) Rabbit Polyclonal Antibody
AP31722PU-N

USD 535.00

2 Weeks

SFRS3 (SRSF3) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide from Human SFRS3.
SFRS3 (SRSF3) Rabbit Polyclonal Antibody
TA314521

USD 380.00

4 Weeks

Rabbit polyclonal anti-SFRS3 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SFRS3.
SFRS3 (SRSF3) (Center) Rabbit Polyclonal Antibody
AP53880PU-N

USD 580.00

2 Weeks

SFRS3 (SRSF3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 81-110 amino acids from the Central region of Human SFRS3
SFRS3 (SRSF3) Rabbit Polyclonal Antibody
TA345823

USD 539.00

5 Days

Rabbit Polyclonal Anti-SFRS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS3 antibody: synthetic peptide directed towards the N terminal of human SFRS3. Synthetic peptide located within the following region: SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS