Rabbit Polyclonal Anti-HS747E2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HS747E2A antibody: synthetic peptide directed towards the middle region of human HS747E2A. Synthetic peptide located within the following region: MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEKKLTVRQDLED |
Rabbit Polyclonal Anti-C22orf31 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C22orf31 antibody: synthetic peptide directed towards the N terminal of human C22orf31. Synthetic peptide located within the following region: ASSFSLVKLVLRRQLKNKCCPPPCKFGEGKLSKRLKHKDDSVMKATQQAR |
Rabbit Polyclonal Anti-C22orf31 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C22orf31 antibody: synthetic peptide directed towards the middle region of human C22orf31. Synthetic peptide located within the following region: GKAIKQKLWEALCSQGAISEGAQRDRFPGRKQPGVHEEPVLKKWPKLKSK |
Germany
Japan
United Kingdom
China