Antibodies

View as table Download

DBT mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DBT mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DBT rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DBT

DBT mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

DBT Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DBT.
Modifications Unmodified

Rabbit Polyclonal Anti-DBT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DBT antibody is: synthetic peptide directed towards the N-terminal region of Human DBT. Synthetic peptide located within the following region: EWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVG

Rabbit Polyclonal Anti-DBT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBT antibody: synthetic peptide directed towards the N terminal of human DBT. Synthetic peptide located within the following region: NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW