Antibodies

Jump to Filters
View as table Download
CNPase (CNP) Mouse Monoclonal Antibody [Clone ID: OTI3C3]
CF811100

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CNP mouse monoclonal antibody,clone OTI3C3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CNPase (CNP) Mouse Monoclonal Antibody [Clone ID: OTI3C3]
TA811100

USD 447.00

In Stock

CNP mouse monoclonal antibody,clone OTI3C3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CNPase (CNP) Rabbit Polyclonal Antibody
TA334679

USD 539.00

5 Days

Rabbit Polyclonal Anti-CNP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNP antibody: synthetic peptide directed towards the middle region of human CNP. Synthetic peptide located within the following region: LYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII
CNPase (CNP) Rabbit Polyclonal Antibody
TA334680

USD 485.00

5 Days

Rabbit Polyclonal Anti-CNP Antibody

Applications IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF
CNPase (CNP) Mouse Monoclonal Antibody [Clone ID: OTI3C3]
TA811100S

USD 200.00

2 Days

CNP mouse monoclonal antibody,clone OTI3C3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

CNPase (CNP) Rabbit Polyclonal Antibody
AP20586PU-N

USD 465.00

3 Weeks

CNPase (CNP) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CNPase (CNP) Chicken Polyclonal Antibody
AP31803PU-N

USD 740.00

2 Weeks

CNPase (CNP) chicken polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide KLH conjugated corresponded to a region of the CNPase gene product shared between the Human (NP_149124) and Mouse (P16330) sequences.
After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks.
CNPase (CNP) Rabbit Polyclonal Antibody
TA309098

USD 490.00

In Stock

rabbit Anti-CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody

Applications WB
Reactivities Mouse, Human, Rabbit, Rat, Sheep
Conjugation Unconjugated
Immunogen Endogenous rabbit 2,3 cyclic nucleotide-3-phospho-diesterase
CNPase (CNP) Rabbit Polyclonal Antibody
TA332390

USD 365.00

3 Weeks

Rabbit anti-CNP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CNP
CNPase (CNP) Rabbit Polyclonal Antibody
TA347838

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CNPase Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CNPase Antibody: Peptide sequence around aa.80~84 (M-V-S-A-D