Antibodies

View as table Download

Rabbit Polyclonal Anti-EIF2C3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF2C3 antibody: synthetic peptide directed towards the N terminal of human EIF2C3. Synthetic peptide located within the following region: MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN

Eif2c3 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated