Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to FAM50A (family with sequence similarity 50, member A)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 149 and 339 of FAM50A (Uniprot ID#Q14320) |
Rabbit polyclonal FAM50A Antibody (C-term)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This FAM50A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 311-339 amino acids from the C-terminal region of human FAM50A. |
Rabbit Polyclonal Anti-FAM50A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM50A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM50A. Synthetic peptide located within the following region: LLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR |
FAM50A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FAM50A |
Active filters
Target Symbol
- FAM50A