Anti-PDCD2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 330-344 amino acids of Human programmed cell death 2 |
Anti-PDCD2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 330-344 amino acids of Human programmed cell death 2 |
Anti-PDCD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 330-344 amino acids of Human programmed cell death 2 |
Rabbit Polyclonal anti-Pdcd2 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Pdcd2 antibody is: synthetic peptide directed towards the middle region of Rat Pdcd2. Synthetic peptide located within the following region: AGLRVFRNQLPRKNAFYSYEPPSETGASDTECVCLQLKSGAHLCRVCGCL |