Carrier-free (BSA/glycerol-free) CNP mouse monoclonal antibody,clone OTI3C3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CNP mouse monoclonal antibody,clone OTI3C3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CNP mouse monoclonal antibody,clone OTI3C3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
CNP mouse monoclonal antibody,clone OTI3C3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
CNP mouse monoclonal antibody,clone OTI3C3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-CNP Antibody
Applications | IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP. Synthetic peptide located within the following region: YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF |
CNP mouse monoclonal antibody,clone OTI3C3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CNPase (CNP) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
rabbit Anti-CNP (2,3-cyclic nucleotide-3-phosphodiesterase) Antibody
Applications | WB |
Reactivities | Mouse, Human, Rabbit, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | Endogenous rabbit 2,3 cyclic nucleotide-3-phospho-diesterase |
Rabbit anti-CNP Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CNP |