Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal DNAL1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | DNAL1 antibody was raised against a 17 amino acid synthetic peptide from near the carboxy terminus of human DNAL1. The immunogen is located within the last 50 amino acids of DNAL1. |
Rabbit polyclonal anti-DNAL1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNAL1. |
Rabbit Polyclonal Anti-DNAL1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dnalc1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dnalc1. Synthetic peptide located within the following region: AEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTP |
DNAL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 41-190 of human DNAL1 (NP_113615.2). |
| Modifications | Unmodified |
DNAL1 (N161) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 128-184 of Human DNAL1. |
Active filters
Target Symbol
- DNAL1
Reactivities
- Mouse