Antibodies

Jump to Filters
View as table Download
SFXN3 Rabbit Polyclonal Antibody
TA339575

USD 539.00

5 Days

Rabbit Polyclonal Anti-SFXN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFXN3 antibody: synthetic peptide directed towards the middle region of human SFXN3. Synthetic peptide located within the following region: TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN
SFXN3 Rabbit Polyclonal Antibody
TA356845

USD 539.00

5 Days

SFXN3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SFXN3