Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-OFLM4 antibody for SISCAPA, clone OTIR2A11
| Applications | FC, SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
OLFM4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Dog, Gorilla, Human, Orang-Utan (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | OLFM4 / Olfactomedin 4 antibody was raised against synthetic 15 amino acid peptide from internal region of human OLFM4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Dog (100%); Gibbon, Monkey, Panda (93%); Marmoset, Bat (87%); Hamster, Rabbit, Pig (80%). |
Rabbit Polyclonal Anti-OLFM4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human OLFM4 |
Rabbit Polyclonal Anti-OLFM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OLFM4 antibody: synthetic peptide directed towards the C terminal of human OLFM4. Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN |
OLFM4 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human OLFM4 |
Rabbit Polyclonal OLFM4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids between 400 and 450 of human OLFM4 was used as immunogen for this antibody. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- OLFM4
Reactivities
- Human