Antibodies

Jump to Filters
View as table Download
CDC34 Rabbit Polyclonal Antibody
TA351064

USD 380.00

In Stock

Rabbit Polyclonal Anti-CDC34 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC34
CDC34 Rabbit Polyclonal Antibody
TA332698

USD 365.00

3 Weeks

Rabbit anti-CDC34 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC34
CDC34 Rabbit Polyclonal Antibody
TA330370

USD 539.00

5 Days

Rabbit Polyclonal Anti-CDC34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC34 antibody: synthetic peptide directed towards the middle region of human CDC34. Synthetic peptide located within the following region: TLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEE
CDC34 Rabbit Polyclonal Antibody
TA354377

USD 425.00

5 Days

Rabbit anti CDC34 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated