Antibodies

Jump to Filters
View as table Download
TLR6 Rabbit Polyclonal Antibody
TA349554

USD 380.00

In Stock

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TLR6
TLR6 Rabbit Polyclonal Antibody
TA350974

USD 380.00

In Stock

Rabbit Polyclonal Anti-TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TLR6
TLR6 Mouse Monoclonal Antibody [Clone ID: 86B1153.2]
TA336394

USD 550.00

5 Days

Mouse Monoclonal TLR6 Antibody (86B1153.2)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
TLR6 Rabbit Polyclonal Antibody
TA306272

USD 570.00

5 Days

Rabbit Polyclonal TLR6 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TLR6 antibody was raised against a peptide corresponding to 13 amino acids near the center of human TLR6.
TLR6 Rabbit Polyclonal Antibody
TA306271

USD 570.00

5 Days

Rabbit Polyclonal TLR6 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TLR6 antibody was raised against a peptide corresponding to 15 amino acids near the amino terminus of human TLR6.
TLR6 Rabbit Polyclonal Antibody
TA329400

USD 539.00

5 Days

Rabbit Polyclonal anti-TLR6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT
TLR6 Rabbit Polyclonal Antibody
TA337082

USD 485.00

5 Days

Rabbit Polyclonal TLR6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Within the range of amino acids 25-56 of human TLR6 protein were used as the immunogen.