Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TOLLIP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TOLLIP mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
5 Days
USD 509.00
5 Days
USD 509.00
5 Days
TOLLIP mouse monoclonal antibody,clone 1D1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TOLLIP mouse monoclonal antibody,clone 1D1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit polyclonal anti-TOLLIP antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TOLLIP. |
Rabbit Polyclonal anti-TOLLIP antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOLLIP antibody: synthetic peptide directed towards the C terminal of human TOLLIP. Synthetic peptide located within the following region: MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG |
Active filters
Target Symbol
- TOLLIP
Pathways
- Toll-like receptor signaling pathway