Antibodies

Jump to Filters
View as table Download
LSS Rabbit Polyclonal Antibody
TA346238

USD 539.00

5 Days

Rabbit Polyclonal Anti-LSS Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-LSS antibody: synthetic peptide directed towards the N terminal of human LSS. Synthetic peptide located within the following region: TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGL
LSS Rabbit Polyclonal Antibody
TA346239

USD 539.00

5 Days

Rabbit Polyclonal Anti-LSS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSS antibody: synthetic peptide directed towards the middle region of human LSS. Synthetic peptide located within the following region: KCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSE