Antibodies

Jump to Filters
View as table Download
SF3B4 Rabbit Polyclonal Antibody
TA315039

USD 380.00

In Stock

Rabbit polyclonal anti-SF3B4 antibody

Applications IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SF3B4.
SF3B4 Rabbit Polyclonal Antibody
TA345931

USD 485.00

5 Days

Rabbit Polyclonal Anti-SF3B4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B4 antibody: synthetic peptide directed towards the N terminal of human SF3B4. Synthetic peptide located within the following region: QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE
SF3B4 Goat Polyclonal Antibody
TA302812

USD 520.00

5 Days

Goat Polyclonal Antibody against SF3B4

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence AAGPISERNQDAT-C, from the N Terminus of the protein sequence according to NP_005841.1.
SF3B4 Rabbit Polyclonal Antibody
TA345932

USD 539.00

5 Days

Rabbit Polyclonal Anti-SF3B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B4 antibody: synthetic peptide directed towards the N terminal of human SF3B4. Synthetic peptide located within the following region: SFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP