Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from the Human Sphingomyelin Synthase 1 protein |
Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from the Human Sphingomyelin Synthase 1 protein |
Rabbit polyclonal Anti-SGMS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGMS1 antibody: synthetic peptide directed towards the middle region of human SGMS1. Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI |
Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from the mouse sphingomyelin synthase 1 protein |