Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to ALDH1A2 (aldehyde dehydrogenase 1 family, member A2)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rat, Xenopus, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 278 and 518 of ALDH1A2 (Uniprot ID#O94788) |
Rabbit polyclonal anti-ALDH1A2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of humanALDH1A2. |
Rabbit Polyclonal Anti-ALDH1A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH1A2 antibody: synthetic peptide directed towards the N terminal of human ALDH1A2. Synthetic peptide located within the following region: PVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRL |
ALDH1A2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ALDH1A2 |
Active filters
Target Symbol
- ALDH1A2
Reactivities
- Human
Pathways
- Retinol metabolism