Antibodies

Jump to Filters
View as table Download
OR5H2 (C-term) Rabbit Polyclonal Antibody
AP53091PU-N

USD 580.00

2 Weeks

OR5H2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 182-312 amino acids from the C-terminal region of human Olfactory receptor 5H2
OR5H2 Rabbit Polyclonal Antibody
TA337526

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR5H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5H2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5H2. Synthetic peptide located within the following region: GAHLLSVSLYYGPLIFMYLRPASPQADDQDMIDSVFYTIIIPLLNPIIYS