ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
ERCC3 mouse monoclonal antibody,clone OTI6H8, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ERCC3 mouse monoclonal antibody,clone OTI6H8, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ERCC3 mouse monoclonal antibody,clone OTI6H8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ERCC3 / XPB Mouse Monoclonal (aa242-261) (3G4) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
ERCC3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ERCC3 |
Rabbit Polyclonal Anti-ERCC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG |
ERCC3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC3 |