Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-SSTR2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 355-369 amino acids of human somatostatin receptor 2 |
Rabbit Polyclonal Somatostatin Receptor 2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-SSTR2 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human (Predicted: Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | SSTR2 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human SSTR2. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Chicken (100%); Platypus, Lizard, Xenopus, Stickleback, Pufferfish (94%); Zebrafish (83%). |
Rabbit Polyclonal Anti-SSTR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSTR2 antibody is: synthetic peptide directed towards the C-terminal region of Human SSTR2. Synthetic peptide located within the following region: KKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
Rabbit Polyclonal Anti-SSTR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSTR2 antibody: synthetic peptide directed towards the middle region of human SSTR2. Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL |
Rabbit Polyclonal Somatostatin Receptor 2 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- SOMATOSTATIN RECEPTOR 2
Pathways
- Neuroactive ligand-receptor interaction