Rabbit Polyclonal Anti-APLNR Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APLNR |
Rabbit Polyclonal Anti-APLNR Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human APLNR |
Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 284 and 376 of Apelin Receptor (Uniprot ID#P35414) |
Rabbit polyclonal anti-AGTRL1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGTRL1. |
Rabbit Polyclonal Anti-APLNR Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human (Predicted: Monkey, Mouse, Rat, Bat, Rabbit) |
Conjugation | Unconjugated |
Immunogen | APLNR/ Apelin Receptor / APJ antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human Apelin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Elephant, Panda, Horse (100%); Orangutan, Marmoset, Mouse, Rat, Bat, Rabbit (94%). |
Rabbit Polyclonal Anti-APLNR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APLNR antibody: synthetic peptide directed towards the N terminal of human APLNR. Synthetic peptide located within the following region: NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW |