Antibodies

View as table Download

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Biotin

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation HRP

Anti-RDH11 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-RDH11 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RDH11

Rabbit Polyclonal Anti-RDH11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11. Synthetic peptide located within the following region: SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR