Antibodies

Jump to Filters
View as table Download
LIPT1 Rabbit Polyclonal Antibody
TA346780

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-LIPT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPT1 antibody: synthetic peptide directed towards the N terminal of human LIPT1. Synthetic peptide located within the following region: NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE
LIPT1 Rabbit Polyclonal Antibody
TA362399

USD 539.00

5 Days

LIPT1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LIPT1