Antibodies

View as table Download

Rabbit Polyclonal EPAC1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EPAC1 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human EPAC1.

Rabbit Polyclonal Anti-RAPGEF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the middle region of human RAPGEF3. Synthetic peptide located within the following region: HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS

Rabbit anti-RAPGEF3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RAPGEF3

Rabbit Polyclonal Anti-RAPGEF3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAPGEF3 antibody: synthetic peptide directed towards the N terminal of human RAPGEF3. Synthetic peptide located within the following region: RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME