CHST6 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Dog, Monkey, Mouse |
Conjugation | Unconjugated |
CHST6 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Dog, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHST6 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Dog, Monkey, Mouse |
Conjugation | Unconjugated |
CHST6 mouse monoclonal antibody,clone 1D1, Biotinylated
Applications | WB |
Reactivities | Human, Dog, Monkey, Mouse |
Conjugation | Biotin |
CHST6 mouse monoclonal antibody,clone 1D1, HRP conjugated
Applications | WB |
Reactivities | Human, Dog, Monkey, Mouse |
Conjugation | HRP |
CHST6 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 303-333 amino acids from the C-terminal region of human CHST6 |
CHST6 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | WB |
Reactivities | Human, Dog, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-CHST6 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHST6. |
Rabbit Polyclonal Anti-CHST6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: YAFTGLSLTPQLEAWIHNITHGSGPGARREAFKTSSRNALNVSQAWRHAL |
Rabbit Polyclonal Anti-CHST6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN |