Antibodies

Jump to Filters
View as table Download
PIGV Rabbit Polyclonal Antibody
TA342041

USD 485.00

5 Days

Rabbit Polyclonal Anti-PIGV Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIGV antibody: synthetic peptide directed towards the N terminal of human PIGV. Synthetic peptide located within the following region: FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE
PIGV (C-term) Rabbit Polyclonal Antibody
AP53301PU-N

USD 580.00

2 Weeks

PIGV (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 342-371aa) of human PIGV.