Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Anti-SEMA3D Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 627-642 amino acids of human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D |
SEMA3D mouse monoclonal antibody,clone OTI2H4
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-SEMA3D Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 627-642 amino acids of human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D |
Rabbit Polyclonal SEMA3D Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Semaphorin 3D (SEMA3D) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 610-640 amino acids from the C-terminal region of Human SEMA3D |
Rabbit polyclonal Anti-SEMA3D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEMA3D antibody: synthetic peptide directed towards the middle region of human SEMA3D. Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- SEMAPHORIN 3D
Pathways
- Axon guidance