UBE2Z Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
UBE2Z Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UBE2Z Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ube2z antibody is: synthetic peptide directed towards the C-terminal region of Rat Ube2z. Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD |