Antibodies

Jump to Filters
View as table Download
ketohexokinase (KHK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F1]
TA501285AM

USD 509.00

2 Weeks

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), Biotinylated

Applications FC, IF, WB
Reactivities Human
Conjugation Biotin
ketohexokinase (KHK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C3]
TA501328AM

USD 509.00

2 Weeks

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI2C3 (formerly 2C3), Biotinylated

Applications FC, IF, WB
Reactivities Human
Conjugation Biotin
ketohexokinase (KHK) Mouse Monoclonal Antibody [Clone ID: OTI4E9]
TA501284S

USD 200.00

2 Days

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4E9 (formerly 4E9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ketohexokinase (KHK) Rabbit Polyclonal Antibody
TA346029

USD 539.00

5 Days

Rabbit Polyclonal Anti-KHK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the C terminal of human KHK. Synthetic peptide located within the following region: FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV
ketohexokinase (KHK) Rabbit Polyclonal Antibody
TA349643

USD 380.00

In Stock

Rabbit Polyclonal Anti-KHK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KHK
ketohexokinase (KHK) Mouse Monoclonal Antibody [Clone ID: OTI3C4]
TA501247S

USD 200.00

2 Days

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ketohexokinase (KHK) Mouse Monoclonal Antibody [Clone ID: OTI4H3]
TA501282S

USD 200.00

2 Days

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ketohexokinase (KHK) Mouse Monoclonal Antibody [Clone ID: OTI4B8]
TA501283S

USD 200.00

2 Days

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ketohexokinase (KHK) Mouse Monoclonal Antibody [Clone ID: OTI1F1]
TA501285S

USD 200.00

2 Days

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ketohexokinase (KHK) Mouse Monoclonal Antibody [Clone ID: OTI2C3]
TA501328S

USD 200.00

2 Days

Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ketohexokinase (KHK) Rabbit Polyclonal Antibody
TA346115

USD 539.00

5 Days

Rabbit Polyclonal Anti-KHK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the N terminal of human KHK. Synthetic peptide located within the following region: FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV