USD 509.00
2 Weeks
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI2C3 (formerly 2C3), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI2C3 (formerly 2C3), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4E9 (formerly 4E9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-KHK Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KHK antibody: synthetic peptide directed towards the C terminal of human KHK. Synthetic peptide located within the following region: FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV |
Rabbit Polyclonal Anti-KHK Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KHK |
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4H3 (formerly 4H3)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI4B8 (formerly 4B8)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-KHK (Ketohexokinase) mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-KHK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KHK antibody: synthetic peptide directed towards the N terminal of human KHK. Synthetic peptide located within the following region: FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV |