Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
HABP2 mouse monoclonal antibody,clone OTI4G9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Antibodies
View as table Download
HABP2 mouse monoclonal antibody,clone OTI4G9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HABP2 mouse monoclonal antibody,clone OTI8D6
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-HABP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HABP2 antibody: synthetic peptide directed towards the middle region of human HABP2. Synthetic peptide located within the following region: EPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTI |
HABP2 mouse monoclonal antibody,clone OTI2B5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HABP2 mouse monoclonal antibody,clone OTI4G9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- HABP2
Reactivities
- Human