Rabbit Polyclonal Anti-SNAPC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNAPC2 antibody: synthetic peptide directed towards the middle region of human SNAPC2. Synthetic peptide located within the following region: STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPL |
Rabbit Polyclonal Anti-SNAPC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNAPC2 antibody: synthetic peptide directed towards the middle region of human SNAPC2. Synthetic peptide located within the following region: STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPL |
Rabbit polyclonal SNAPC2 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SNAPC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 278-307 amino acids from the C-terminal region of human SNAPC2. |
Rabbit Polyclonal anti-SNAPC2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNAPC2 antibody: synthetic peptide directed towards the N terminal of human SNAPC2. Synthetic peptide located within the following region: LQARQGQPEPDATELARELRGRSEAEIRVFLQQLKGRVAREAIQKVHPGG |
Rabbit Polyclonal Anti-SNAPC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SNAPC2 antibody is: synthetic peptide directed towards the C-terminal region of Human SNAPC2. Synthetic peptide located within the following region: EEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPLLP |
Germany
Japan
United Kingdom
China
