Antibodies

Jump to Filters
View as table Download
Serum Amyloid P (APCS) Rabbit Polyclonal Antibody
TA346302

USD 485.00

5 Days

Rabbit Polyclonal Anti-APCS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APCS antibody: synthetic peptide directed towards the N terminal of human APCS. Synthetic peptide located within the following region: NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
Serum Amyloid P (APCS) Rabbit Polyclonal Antibody
TA327226

USD 365.00

3 Weeks

Rabbit anti-APCS Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human APCS